Lineage for d1ek2a2 (1ek2 A:226-544)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151394Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins)
  6. 2151408Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)
  7. 2151454Species Mouse (Mus musculus) [TaxId:10090] [53527] (4 PDB entries)
  8. 2151461Domain d1ek2a2: 1ek2 A:226-544 [34691]
    Other proteins in same PDB: d1ek2a1, d1ek2b1
    complexed with cdu

Details for d1ek2a2

PDB Entry: 1ek2 (more details), 3 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase complexed with cdu inhibitor
PDB Compounds: (A:) epoxide hydrolase

SCOPe Domain Sequences for d1ek2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ek2a2 c.69.1.11 (A:226-544) Mammalian epoxide hydrolase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
lpvpcnpndvshgyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfr
vlaidmkgygdsssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalf
ypervravaslntpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfks
ffrasdetgfiavhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwy
rnternwkwsckglgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwt
qiekptevnqilikwlqte

SCOPe Domain Coordinates for d1ek2a2:

Click to download the PDB-style file with coordinates for d1ek2a2.
(The format of our PDB-style files is described here.)

Timeline for d1ek2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ek2a1