Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.11: Epoxide hydrolase [53525] (2 proteins) |
Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [53527] (4 PDB entries) |
Domain d1cqzb2: 1cqz B:226-544 [34690] Other proteins in same PDB: d1cqza1, d1cqzb1 |
PDB Entry: 1cqz (more details), 2.8 Å
SCOP Domain Sequences for d1cqzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cqzb2 c.69.1.11 (B:226-544) Mammalian epoxide hydrolase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} lpvpcnpndvshgyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfr vlaidmkgygdsssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalf ypervravaslntpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfks ffrasdetgfiavhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwy rnternwkwsckglgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwt qiekptevnqilikwlqte
Timeline for d1cqzb2: