Lineage for d5n9zd2 (5n9z D:154-484)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2447081Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2447082Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2447312Protein automated matches [226984] (16 species)
    not a true protein
  7. 2447523Species Thalassiosira hyalina [TaxId:1234817] [346766] (1 PDB entry)
  8. 2447527Domain d5n9zd2: 5n9z D:154-484 [346897]
    Other proteins in same PDB: d5n9za1, d5n9zb1, d5n9zc1, d5n9zd1, d5n9ze1, d5n9zf1, d5n9zg1, d5n9zh1, d5n9zi_, d5n9zj_, d5n9zk_, d5n9zl_, d5n9zm_, d5n9zn_, d5n9zo_, d5n9zp_
    automated match to d1bwva1
    complexed with cap, edo, mg

Details for d5n9zd2

PDB Entry: 5n9z (more details), 1.9 Å

PDB Description: rubisco from thalassiosira hyalina
PDB Compounds: (D:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d5n9zd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n9zd2 c.1.14.1 (D:154-484) automated matches {Thalassiosira hyalina [TaxId: 1234817]}
gpatgiivererlnkygtpllgatvkpklglsgknygrvvyeglxggldflkddeninsq
pfmrwrerflncleginraaaatgevkgsylnitaatmeevykraeyakaigsvvvmidl
vmgytaiqsiaywarendmllhlhragnstyarqknhginfrvickwmrmsgvdhihagt
vvgklegdplmikgfydvlrltelevnlpfgiffemdwaslrrcmpvasggihcgqmhql
ihylgddvvlqfgggtighpdgiqagatanrvaleamvlarnegadyfnnqvgpqilrda
aktcgplqtaldlwkdisfnytstdtadfae

SCOPe Domain Coordinates for d5n9zd2:

Click to download the PDB-style file with coordinates for d5n9zd2.
(The format of our PDB-style files is described here.)

Timeline for d5n9zd2: