Lineage for d1cqza2 (1cqz A:226-544)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26774Family c.69.1.11: Epoxide hydrolase [53525] (2 proteins)
  6. 26784Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (1 species)
  7. 26785Species Mouse (Mus musculus) [TaxId:10090] [53527] (4 PDB entries)
  8. 26790Domain d1cqza2: 1cqz A:226-544 [34689]
    Other proteins in same PDB: d1cqza1, d1cqzb1

Details for d1cqza2

PDB Entry: 1cqz (more details), 2.8 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase.

SCOP Domain Sequences for d1cqza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cqza2 c.69.1.11 (A:226-544) Mammalian epoxide hydrolase, C-terminal domain {Mouse (Mus musculus)}
lpvpcnpndvshgyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfr
vlaidmkgygdsssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalf
ypervravaslntpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfks
ffrasdetgfiavhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwy
rnternwkwsckglgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwt
qiekptevnqilikwlqte

SCOP Domain Coordinates for d1cqza2:

Click to download the PDB-style file with coordinates for d1cqza2.
(The format of our PDB-style files is described here.)

Timeline for d1cqza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cqza1