SCOPe 2.08: Domain d5nm6b_: 5nm6 B:

Lineage for d5nm6b_ (5nm6 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [227626] (11 PDB entries)

8. Domain d5nm6b_: 5nm6 B: [346885]
   automated match to d5jpgb_

Details for d5nm6b_

PDB Entry: 5nm6, 1.46 Å

PDB Description: chicken grifin (crystallisation ph: 4.6)

PDB Compounds: (B:) galectin

SCOPe Domain Sequences for d5nm6b_:

Sequence; same for both SEQRES and ATOM records:

>d5nm6b_ b.29.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
ilndieissveitkrgl

Timeline for d5nm6b_:

• d5nm6b_ first appeared in SCOPe 2.07