Lineage for d5ndub1 (5ndu B:1-111)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. Protein automated matches [226957] (2 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225382] (12 PDB entries)
  8. Domain d5ndub1: 5ndu B:1-111 [346883]
    Other proteins in same PDB: d5ndub2
    automated match to d2iyba_
    complexed with 8v2, gol, no3, so4

Details for d5ndub1

PDB Entry: 5ndu (more details), 1.42 Å

PDB Description: enah evh1 in complex with ac-[2-cl-f]-[prom-2]-[prom-12]-ome
PDB Compounds: (B:) Protein enabled homolog

SCOPe Domain Sequences for d5ndub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ndub1 b.55.1.4 (B:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

SCOPe Domain Coordinates for d5ndub1 are not available.

Timeline for d5ndub1:

Domains from same chain:
(mouse over for more information)
d5ndub2
Domains from other chains:
(mouse over for more information)
d5ndua_