Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [227626] (11 PDB entries) |
Domain d5nm1a_: 5nm1 A: [346882] automated match to d5jpgb_ |
PDB Entry: 5nm1 (more details), 2.1 Å
SCOPe Domain Sequences for d5nm1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nm1a_ b.29.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq ilndieissveitkrg
Timeline for d5nm1a_: