Lineage for d5nm1a_ (5nm1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780743Species Chicken (Gallus gallus) [TaxId:9031] [227626] (11 PDB entries)
  8. 2780765Domain d5nm1a_: 5nm1 A: [346882]
    automated match to d5jpgb_

Details for d5nm1a_

PDB Entry: 5nm1 (more details), 2.1 Å

PDB Description: chicken grifin (crystallisation ph: 6.2)
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d5nm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nm1a_ b.29.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
ilndieissveitkrg

SCOPe Domain Coordinates for d5nm1a_:

Click to download the PDB-style file with coordinates for d5nm1a_.
(The format of our PDB-style files is described here.)

Timeline for d5nm1a_: