SCOP 1.71: Domain d1cr6b2: 1cr6 B:226-544

Lineage for d1cr6b2 (1cr6 B:226-544)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.11: Epoxide hydrolase [53525] (2 proteins)

6. Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [53527] (4 PDB entries)

8. Domain d1cr6b2: 1cr6 B:226-544 [34688]
   Other proteins in same PDB: d1cr6a1, d1cr6b1

Details for d1cr6b2

PDB Entry: 1cr6, 2.8 Å

PDB Description: crystal structure of murine soluble epoxide hydrolase complexed with cpu inhibitor

SCOP Domain Sequences for d1cr6b2:

Sequence; same for both SEQRES and ATOM records:

>d1cr6b2 c.69.1.11 (B:226-544) Mammalian epoxide hydrolase, C-terminal domain {Mouse (Mus musculus)}
lpvpcnpndvshgyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfr
vlaidmkgygdsssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalf
ypervravaslntpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfks
ffrasdetgfiavhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwy
rnternwkwsckglgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwt
qiekptevnqilikwlqte

Timeline for d1cr6b2:

• d1cr6b2 first appeared (with stable ids) in SCOP 1.55
  
• d1cr6b2 appears in SCOP 1.69
  
• d1cr6b2 appears in SCOP 1.73
  
• d1cr6b2 appears in the current release, SCOPe 2.08