| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families) ![]() |
| Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins) |
| Protein automated matches [191289] (2 species) not a true protein |
| Species Escherichia coli [TaxId:562] [346827] (1 PDB entry) |
| Domain d5nhia_: 5nhi A: [346878] automated match to d1l6pa_ |
PDB Entry: 5nhi (more details), 2.6 Å
SCOPe Domain Sequences for d5nhia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nhia_ b.1.17.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwaggs
eiyrdrltlpvtinqasagatltvtyqgcadagfcyppetktvplsevvan
Timeline for d5nhia_: