SCOPe 2.08: Domain d5nhia_: 5nhi A:

Lineage for d5nhia_ (5nhi A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.17: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74863] (2 families)

5. Family b.1.17.1: Thiol:disulfide interchange protein DsbD, N-terminal domain (DsbD-alpha) [74864] (2 proteins)

6. Protein automated matches [191289] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [346827] (1 PDB entry)

8. Domain d5nhia_: 5nhi A: [346878]
   automated match to d1l6pa_

Details for d5nhia_

PDB Entry: 5nhi, 2.6 Å

PDB Description: crystal structure of the escherichia coli n-terminal domain of dsbd (ndsbd) without the cap-loop region

PDB Compounds: (A:) Thiol:disulfide interchange protein dsbD

SCOPe Domain Sequences for d5nhia_:

Sequence; same for both SEQRES and ATOM records:

>d5nhia_ b.1.17.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
qfvpadqafafdfqqnqhdlnltwqikdgyylyrkqiritpehakiadvqlpqgvwaggs
eiyrdrltlpvtinqasagatltvtyqgcadagfcyppetktvplsevvan

Timeline for d5nhia_:

• d5nhia_ first appeared in SCOPe 2.07