Lineage for d5nleb_ (5nle B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (57 species)
    not a true protein
  7. 2375204Species Chicken (Gallus gallus) [TaxId:9031] [227626] (11 PDB entries)
  8. 3046808Domain d5nleb_: 5nle B: [346870]
    automated match to d5jpgb_
    complexed with lbt

Details for d5nleb_

PDB Entry: 5nle (more details), 1.85 Å

PDB Description: chicken grifin (crystallisation ph: 8.0)
PDB Compounds: (B:) galectin

SCOPe Domain Sequences for d5nleb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nleb_ b.29.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
alrfealypegmcpgwsvvvkgktssntsmfeinflshpgdqiafhfnprfassrivcns
flanhwgkeevnktfpfeakepfqveiysdqdyfhifidenkilqykhrqkqlssitklq
ilndieissveitkr

SCOPe Domain Coordinates for d5nleb_:

Click to download the PDB-style file with coordinates for d5nleb_.
(The format of our PDB-style files is described here.)

Timeline for d5nleb_:

  • d5nleb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-05