![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.11: Epoxide hydrolase [53525] (3 proteins) |
![]() | Protein Mammalian epoxide hydrolase, C-terminal domain [53526] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [53527] (4 PDB entries) |
![]() | Domain d1cr6a2: 1cr6 A:226-544 [34687] Other proteins in same PDB: d1cr6a1, d1cr6b1 complexed with cpu |
PDB Entry: 1cr6 (more details), 2.8 Å
SCOPe Domain Sequences for d1cr6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cr6a2 c.69.1.11 (A:226-544) Mammalian epoxide hydrolase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} lpvpcnpndvshgyvtvkpgirlhfvemgsgpalclchgfpeswfswryqipalaqagfr vlaidmkgygdsssppeieeyamellckemvtfldklgipqavfighdwagvmvwnmalf ypervravaslntpfmppdpdvspmkvirsipvfnyqlyfqepgvaeaeleknmsrtfks ffrasdetgfiavhkateiggilvntpedpnlskitteeeiefyiqqfkktgfrgplnwy rnternwkwsckglgrkilvpalmvtaekdivlrpemsknmekwipflkrghiedcghwt qiekptevnqilikwlqte
Timeline for d1cr6a2: