Lineage for d5mz2o_ (5mz2 O:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564397Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2564398Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2564681Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2564682Protein automated matches [336552] (9 species)
    not a true protein
  7. 2564714Species Thalassiosira antarctica [TaxId:555753] [346585] (1 PDB entry)
  8. 2564721Domain d5mz2o_: 5mz2 O: [346860]
    Other proteins in same PDB: d5mz2a1, d5mz2a2, d5mz2b1, d5mz2b2, d5mz2c1, d5mz2c2, d5mz2d1, d5mz2d2, d5mz2e1, d5mz2e2, d5mz2f1, d5mz2f2, d5mz2g1, d5mz2g2, d5mz2h1, d5mz2h2
    automated match to d1iwab_
    complexed with cap, edo, mg

Details for d5mz2o_

PDB Entry: 5mz2 (more details), 1.9 Å

PDB Description: rubisco from thalassiosira antarctica
PDB Compounds: (O:) Rubisco small subunit

SCOPe Domain Sequences for d5mz2o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mz2o_ d.73.1.0 (O:) automated matches {Thalassiosira antarctica [TaxId: 555753]}
mrltqgcfsflpdltdqqiekqvacamsrglamnvewtddphprnnywelwglplfdikd
patvmfelnearkscaagyirmnafdasygtescvmsfitnrpanepgfyldrtegvgrq
ivysiksysvqanpegsry

SCOPe Domain Coordinates for d5mz2o_:

Click to download the PDB-style file with coordinates for d5mz2o_.
(The format of our PDB-style files is described here.)

Timeline for d5mz2o_: