Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Plasmodium falciparum [TaxId:36329] [225359] (7 PDB entries) |
Domain d5nfre1: 5nfr E:1-143 [346851] Other proteins in same PDB: d5nfra2, d5nfrb2, d5nfrc2, d5nfrd2, d5nfre2, d5nfrf2, d5nfrg2, d5nfrh2, d5nfri2, d5nfrj2, d5nfrk2, d5nfrl2, d5nfrm2, d5nfrn2, d5nfro2, d5nfrp2 automated match to d3p7ma1 complexed with cit |
PDB Entry: 5nfr (more details), 2.4 Å
SCOPe Domain Sequences for d5nfre1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nfre1 c.2.1.0 (E:1-143) automated matches {Plasmodium falciparum [TaxId: 36329]} mtkialigsgqigaivgelcllenlgdlilydvvpgipqgkaldlkhfstilgvnrnilg tnqiedikdadiivitagvqrkegmtredligvngkimksvaesvklhcskafvicvsnp ldimvnvfhkfsnlphekicgma
Timeline for d5nfre1:
View in 3D Domains from other chains: (mouse over for more information) d5nfra1, d5nfra2, d5nfrb1, d5nfrb2, d5nfrc1, d5nfrc2, d5nfrd1, d5nfrd2, d5nfrf1, d5nfrf2, d5nfrg1, d5nfrg2, d5nfrh1, d5nfrh2, d5nfri1, d5nfri2, d5nfrj1, d5nfrj2, d5nfrk1, d5nfrk2, d5nfrl1, d5nfrl2, d5nfrm1, d5nfrm2, d5nfrn1, d5nfrn2, d5nfro1, d5nfro2, d5nfrp1, d5nfrp2 |