Lineage for d5nfrc2 (5nfr C:144-313)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2999522Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2999523Protein automated matches [226850] (47 species)
    not a true protein
  7. 2999730Species Plasmodium falciparum [TaxId:36329] [346822] (1 PDB entry)
  8. 2999733Domain d5nfrc2: 5nfr C:144-313 [346850]
    Other proteins in same PDB: d5nfra1, d5nfrb1, d5nfrc1, d5nfrd1, d5nfre1, d5nfrf1, d5nfrg1, d5nfrh1, d5nfri1, d5nfrj1, d5nfrk1, d5nfrl1, d5nfrm1, d5nfrn1, d5nfro1, d5nfrp1
    automated match to d3p7ma2
    complexed with cit

Details for d5nfrc2

PDB Entry: 5nfr (more details), 2.4 Å

PDB Description: crystal structure of malate dehydrogenase from plasmodium falciparum (pfmdh)
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d5nfrc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nfrc2 d.162.1.0 (C:144-313) automated matches {Plasmodium falciparum [TaxId: 36329]}
gildtsrycsliadklkvsaedvnavilgghgdlmvplqrytsvngvplsefvkknmisq
neiqeiiqktrnmgaeiiklakasaafapaaaitkmiksylynennlftcavylnghync
snlfvgstakinnkgahpvefpltkeeqdlytesiasvqsntqkafdlik

SCOPe Domain Coordinates for d5nfrc2:

Click to download the PDB-style file with coordinates for d5nfrc2.
(The format of our PDB-style files is described here.)

Timeline for d5nfrc2: