Lineage for d5negb_ (5neg B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394770Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 2394806Protein automated matches [226957] (2 species)
    not a true protein
  7. 2394807Species Human (Homo sapiens) [TaxId:9606] [225382] (12 PDB entries)
  8. 3046767Domain d5negb_: 5neg B: [346829]
    automated match to d2iyba_
    complexed with 8vk, no3, so4

Details for d5negb_

PDB Entry: 5neg (more details), 1.29 Å

PDB Description: enah evh1 in complex with ac-[2-cl-f]-[prom-2]-[prom-13]-oet
PDB Compounds: (B:) Protein enabled homolog

SCOPe Domain Sequences for d5negb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5negb_ b.55.1.4 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvinc
aipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

SCOPe Domain Coordinates for d5negb_:

Click to download the PDB-style file with coordinates for d5negb_.
(The format of our PDB-style files is described here.)

Timeline for d5negb_:

  • d5negb_ is new in SCOPe 2.07-stable