Lineage for d5mzmb_ (5mzm B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2348365Protein beta2-microglobulin [88600] (6 species)
  7. 2349059Species Mouse (Mus musculus) [TaxId:10090] [88603] (215 PDB entries)
    Uniprot P01887
  8. 3046752Domain d5mzmb_: 5mzm B: [346814]
    Other proteins in same PDB: d5mzma1, d5mzma2, d5mzmd1, d5mzmd2
    automated match to d1lk2b_
    complexed with gol, so4

Details for d5mzmb_

PDB Entry: 5mzm (more details), 2.4 Å

PDB Description: structure of h-2db in complex with teipp apl trh4 p3p
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d5mzmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mzmb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d5mzmb_:

Click to download the PDB-style file with coordinates for d5mzmb_.
(The format of our PDB-style files is described here.)

Timeline for d5mzmb_:

  • d5mzmb_ appears in periodic updates to SCOPe 2.07 starting on 2018-04-05