Lineage for d5nata_ (5nat A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. Protein automated matches [190438] (35 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [187421] (100 PDB entries)
  8. Domain d5nata_: 5nat A: [346810]
    automated match to d1op8a_
    complexed with 8rt, gol

Details for d5nata_

PDB Entry: 5nat (more details), 1.1700000000000002 Å

PDB Description: complement factor d in complex with the inhibitor (s)-pyrrolidine-1,2- dicarboxylic acid 1-[(1-methyl-1h-indol-3-yl)-amide] 2-[(3- trifluoromethoxy-phenyl)-amide]
PDB Compounds: (A:) complement factor d

SCOPe Domain Sequences for d5nata_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nata_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ilggreaeaharpymasvqlngahlcggvlvaeqwvlsaahcledaadgkvqvllgahsl
sqpepskrlydvlravphpdsqpdtidhdllllqlsekatlgpavrplpwqrvdrdvapg
tlcdvagwgivnhagrrpdslqhvllpvldratcnrrthhdgaiterlmcaesnrrdsck
gdsggplvcggvlegvvtsgsrvcgnrkkpgiytrvasyaawidsvla

SCOPe Domain Coordinates for d5nata_ are not available.

Timeline for d5nata_: