Lineage for d1cv2a_ (1cv2 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26738Family c.69.1.8: Haloalkane dehalogenase [53513] (1 protein)
  6. 26739Protein Haloalkane dehalogenase [53514] (3 species)
  7. 26744Species Sphingomonas paucimobilis, UT26, LinB [TaxId:13689] [53517] (2 PDB entries)
  8. 26745Domain d1cv2a_: 1cv2 A: [34680]

Details for d1cv2a_

PDB Entry: 1cv2 (more details), 1.58 Å

PDB Description: hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 at 1.6 a resolution

SCOP Domain Sequences for d1cv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cv2a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB}
gakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacdl
igmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhre
rvqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrpls
eaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfina
epgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa

SCOP Domain Coordinates for d1cv2a_:

Click to download the PDB-style file with coordinates for d1cv2a_.
(The format of our PDB-style files is described here.)

Timeline for d1cv2a_: