Lineage for d1cv2a_ (1cv2 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2475032Family c.69.1.8: Haloalkane dehalogenase [53513] (2 protein domains)
  6. 2475033Protein Haloalkane dehalogenase [53514] (4 species)
  7. 2475040Species Sphingomonas paucimobilis, UT26, LinB [TaxId:13689] [53517] (12 PDB entries)
  8. 2475050Domain d1cv2a_: 1cv2 A: [34680]

Details for d1cv2a_

PDB Entry: 1cv2 (more details), 1.58 Å

PDB Description: hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 at 1.6 a resolution
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d1cv2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cv2a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}
gakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacdl
igmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhre
rvqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrpls
eaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfina
epgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpa

SCOPe Domain Coordinates for d1cv2a_:

Click to download the PDB-style file with coordinates for d1cv2a_.
(The format of our PDB-style files is described here.)

Timeline for d1cv2a_: