SCOPe 2.08: Domain d5ncga1: 5ncg A:1-111

Lineage for d5ncga1 (5ncg A:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)

6. Protein automated matches [226957] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225382] (12 PDB entries)

8. Domain d5ncga1: 5ncg A:1-111 [346797]
   Other proteins in same PDB: d5ncga2, d5ncgb2
   automated match to d2iyba_
   complexed with 8tb, no3

Details for d5ncga1

PDB Entry: 5ncg, 1.02 Å

PDB Description: enah evh1 in complex with ac-[2-cl-f]-[prom-2]-[prom-9]-oh

PDB Compounds: (A:) Protein enabled homolog

SCOPe Domain Sequences for d5ncga1:

Sequence; same for both SEQRES and ATOM records:

>d5ncga1 b.55.1.4 (A:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi
ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevl

Timeline for d5ncga1:

• d5ncga1 first appeared in SCOPe 2.07