![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins) automatically mapped to Pfam PF07953 |
![]() | Protein automated matches [229097] (6 species) not a true protein |
![]() | Species Clostridium botulinum [TaxId:1491] [229098] (12 PDB entries) |
![]() | Domain d5mk7a1: 5mk7 A:886-1092 [346769] Other proteins in same PDB: d5mk7a2 automated match to d5jlva1 |
PDB Entry: 5mk7 (more details), 1.8 Å
SCOPe Domain Sequences for d5mk7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mk7a1 b.29.1.6 (A:886-1092) automated matches {Clostridium botulinum [TaxId: 1491]} nhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivynsmyenfstsf wiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikqrvvfkysqmi nisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimfkldgcrdthr yiwikyfnlfdkelnekeikdlydnqs
Timeline for d5mk7a1: