SCOP 1.73: Domain d1hdeb_: 1hde B:

Lineage for d1hdeb_ (1hde B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (1 protein)

6. Protein Haloalkane dehalogenase [53514] (3 species)

7. Species Xanthobacter autotrophicus [TaxId:280] [53515] (15 PDB entries)

8. Domain d1hdeb_: 1hde B: [34676]
   mutant

Details for d1hdeb_

PDB Entry: 1hde, 2.7 Å

PDB Description: haloalkane dehalogenase mutant with phe 172 replaced with trp

PDB Compounds: (B:) haloalkane dehalogenase

SCOP Domain Sequences for d1hdeb_:

Sequence; same for both SEQRES and ATOM records:

>d1hdeb_ c.69.1.8 (B:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}
minairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgwtawkydlv
tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
ealkhfaete

Timeline for d1hdeb_:

• d1hdeb_ first appeared (with stable ids) in SCOP 1.55
  
• d1hdeb_ appears in SCOP 1.71
  
• d1hdeb_ appears in SCOP 1.75
  
• d1hdeb_ appears in the current release, SCOPe 2.08