Lineage for d1beea_ (1bee A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900279Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2900280Protein Haloalkane dehalogenase [53514] (4 species)
  7. 2900300Species Xanthobacter autotrophicus [TaxId:280] [53515] (17 PDB entries)
  8. 2900316Domain d1beea_: 1bee A: [34673]
    mutant

Details for d1beea_

PDB Entry: 1bee (more details), 2.6 Å

PDB Description: haloalkane dehalogenase mutant with trp 175 replaced by tyr
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d1beea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beea_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}
mvnairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftaykydlv
tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
ealkhfaete

SCOPe Domain Coordinates for d1beea_:

Click to download the PDB-style file with coordinates for d1beea_.
(The format of our PDB-style files is described here.)

Timeline for d1beea_: