SCOPe 2.08: Domain d5bjzl2: 5bjz L:110-216

Lineage for d5bjzl2 (5bjz L:110-216)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5bjzl2: 5bjz L:110-216 [346724]
   Other proteins in same PDB: d5bjza1, d5bjza2, d5bjzb_, d5bjzc_, d5bjzd_, d5bjzh1, d5bjzl1
   automated match to d4jg1l2
   complexed with cl, epe, gol

Details for d5bjzl2

PDB Entry: 5bjz, 1.95 Å

PDB Description: crystal structure of maltose binding protein in complex with an allosteric synthetic antibody

PDB Compounds: (L:) Synthetic antibody, Fab fragment, Light Chain

SCOPe Domain Sequences for d5bjzl2:

Sequence; same for both SEQRES and ATOM records:

>d5bjzl2 b.1.1.2 (L:110-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d5bjzl2:

• d5bjzl2 first appeared in SCOPe 2.07