Lineage for d5moid1 (5moi D:335-438)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750495Domain d5moid1: 5moi D:335-438 [346712]
    automated match to d1ls0a5
    complexed with edo, peg, po4

Details for d5moid1

PDB Entry: 5moi (more details), 2.2 Å

PDB Description: crystal structure of human ige-fc epsilon 3-4
PDB Compounds: (D:) ig epsilon chain c region

SCOPe Domain Sequences for d5moid1:

Sequence, based on SEQRES records: (download)

>d5moid1 b.1.1.2 (D:335-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsaylsrpspfdlfirksptitclvvdlapskgtvqltwsrasgkpvqhstrkeekqrn
gtltvtstlpvgtrdwiegetyqcrvthphlpralmrsttktsg

Sequence, based on observed residues (ATOM records): (download)

>d5moid1 b.1.1.2 (D:335-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gvsaylsrpspfdlfirksptitclvvdtvqltwsrasgkpvqhstrkeekqrngtltvt
stlpvgtrdwiegetyqcrvtlmrsttktsg

SCOPe Domain Coordinates for d5moid1:

Click to download the PDB-style file with coordinates for d5moid1.
(The format of our PDB-style files is described here.)

Timeline for d5moid1: