SCOPe 2.08: Domain d5n48b_: 5n48 B:

Lineage for d5n48b_ (5n48 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein automated matches [190888] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188282] (33 PDB entries)

8. Domain d5n48b_: 5n48 B: [346702]
   Other proteins in same PDB: d5n48a_, d5n48c_, d5n48d2
   automated match to d2fnba_

Details for d5n48b_

PDB Entry: 5n48, 1.6 Å

PDB Description: structure of anticalin n9b in complex with extra-domain b of human oncofetal fibronectin

PDB Compounds: (B:) Fibronectin

SCOPe Domain Sequences for d5n48b_:

Sequence; same for both SEQRES and ATOM records:

>d5n48b_ b.1.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evpqltdlsfvditdssiglrwtplnsstiigyritvvaagegipifedfvdssvgyytv
tglepgidydisvitlinggesapttltqqta

Timeline for d5n48b_:

• d5n48b_ first appeared in SCOPe 2.07