| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries) |
| Domain d5mk8b1: 5mk8 B:862-1071 [346700] Other proteins in same PDB: d5mk8a2, d5mk8b2 automated match to d5v38a1 complexed with cl, fmt |
PDB Entry: 5mk8 (more details), 1.95 Å
SCOPe Domain Sequences for d5mk8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mk8b1 b.29.1.0 (B:862-1071) automated matches {Clostridium botulinum [TaxId: 1491]}
kyncilnikyemdrdklvdssgyrsrinigtgvkfseidknqvqlsnlesskievilnng
viynsmyenfstsfwiripkyfrninneykiiscmqnnsgwevslnfsnmnskiiwtlqd
tegikktvvfqytqninisdyinrwifvtitnnrlsnskiyingrlineesisdlgniha
snnimfkldgcrdphryiwikyfnlfdkel
Timeline for d5mk8b1: