SCOP 1.55: Domain d1edd__: 1edd -

Lineage for d1edd__ (1edd -)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families)

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (1 protein)

6. Protein Haloalkane dehalogenase [53514] (3 species)

7. Species Xanthobacter autotrophicus [53515] (15 PDB entries)

8. Domain d1edd__: 1edd - [34669]

Details for d1edd__

PDB Entry: 1edd, 2.1 Å

PDB Description: crystallographic and fluorescence studies of the interaction of haloalkane dehalogenase with halide ions: studies with halide compounds reveal a halide binding site in the active site

SCOP Domain Sequences for d1edd__:

Sequence; same for both SEQRES and ATOM records:

>d1edd__ c.69.1.8 (-) Haloalkane dehalogenase {Xanthobacter autotrophicus}
minairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftawkydlv
tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
ealkhfaete

Timeline for d1edd__:

• d1edd__ appears in SCOP 1.57
  
• d1edd__ appears in the current release, SCOPe 2.08, called d1edda_