SCOPe 2.08: Domain d5n57b2: 5n57 B:91-199

Lineage for d5n57b2 (5n57 B:91-199)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [346687] (6 PDB entries)

8. Domain d5n57b2: 5n57 B:91-199 [346688]
   Other proteins in same PDB: d5n57a1, d5n57b1
   automated match to d2awpa2
   complexed with mn

Details for d5n57b2

PDB Entry: 5n57, 2.3 Å

PDB Description: staphylococcus aureus cambialistic superoxide dismutase sodm

PDB Compounds: (B:) superoxide dismutase

SCOPe Domain Sequences for d5n57b2:

Sequence; same for both SEQRES and ATOM records:

>d5n57b2 d.44.1.0 (B:91-199) automated matches {Staphylococcus aureus [TaxId: 1280]}
nseekggviddikaqwgtldefknefankattlfgsgwtwlvvndgkleivttpnqdnpl
tegktpillfdvwehayylkyqnkrpdymtafwnivnwkkvdelyqaak

Timeline for d5n57b2:

• d5n57b2 first appeared in SCOPe 2.07