Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (39 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [346685] (6 PDB entries) |
Domain d5n57b1: 5n57 B:2-90 [346686] Other proteins in same PDB: d5n57a2, d5n57b2 automated match to d2awpa1 complexed with mn |
PDB Entry: 5n57 (more details), 2.3 Å
SCOPe Domain Sequences for d5n57b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5n57b1 a.2.11.0 (B:2-90) automated matches {Staphylococcus aureus [TaxId: 1280]} afklpnlpyaydalepyidqrtmefhhdkhhntyvtklnatvegtelehqsladmianld kvpeamrmsvrnnggghfnhslfweilsp
Timeline for d5n57b1: