Lineage for d5bk1d2 (5bk1 D:109-216)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750893Domain d5bk1d2: 5bk1 D:109-216 [346681]
    Other proteins in same PDB: d5bk1a_, d5bk1b_, d5bk1c_, d5bk1d1, d5bk1h_, d5bk1l1
    automated match to d1dn0a2
    complexed with cl, gol

Details for d5bk1d2

PDB Entry: 5bk1 (more details), 2.15 Å

PDB Description: crystal structure of maltose binding protein in complex with an endosteric synthetic antibody
PDB Compounds: (D:) Synthetic antibody, Fab fragment, Light Chain

SCOPe Domain Sequences for d5bk1d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5bk1d2 b.1.1.2 (D:109-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdsqlksgtasvvcllnnfypreakvqwsvdnalqsgnsqesvteq
dskdstyslsstltlssadyekhkvyacevthqglsspvtksfnrgec

SCOPe Domain Coordinates for d5bk1d2:

Click to download the PDB-style file with coordinates for d5bk1d2.
(The format of our PDB-style files is described here.)

Timeline for d5bk1d2: