Lineage for d5mrta_ (5mrt A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404159Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2404359Protein automated matches [190306] (9 species)
    not a true protein
  7. 2404403Species Lysobacter sp. [TaxId:186334] [346641] (1 PDB entry)
  8. 2404404Domain d5mrta_: 5mrt A: [346679]
    automated match to d2h5ca_
    complexed with cl, fmt, gol, na

Details for d5mrta_

PDB Entry: 5mrt (more details), 1.6 Å

PDB Description: crystal structure of l5 protease lysobacter sp. xl1
PDB Compounds: (A:) Lytic endopeptidase preproenzyme

SCOPe Domain Sequences for d5mrta_:

Sequence, based on SEQRES records: (download)

>d5mrta_ b.47.1.1 (A:) automated matches {Lysobacter sp. [TaxId: 186334]}
atvqggieyrmplpdgrvglcsvgfpvtkgtikgfataghcakagqsvqisgvnvgtfta
shfpntdrawvtigaahtllgsvtnytggsvavkgsteaaigaavcrsgrttqykcgtit
aknvtvnygtlgtvsgltrannctgrgdsggswitaagqaqgltsggnlpagqndncsvp
tsqrqtyferinpvlsqyglalvts

Sequence, based on observed residues (ATOM records): (download)

>d5mrta_ b.47.1.1 (A:) automated matches {Lysobacter sp. [TaxId: 186334]}
atvqggieyrmplpdgrvglcsvgfpvtkgtikgfataghcakagqsvqisgvnvgtfta
shfpntdrawvtigaahtllgsvtnytggsvavkgsteaaigaavcrsgrttqykcgtit
aknvtvnygtlgtvsgltrannctgrgdsggswitaagqaqgltsggnlpasqrqtyfer
inpvlsqyglalvts

SCOPe Domain Coordinates for d5mrta_:

Click to download the PDB-style file with coordinates for d5mrta_.
(The format of our PDB-style files is described here.)

Timeline for d5mrta_: