Lineage for d1beza_ (1bez A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2507846Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2507847Protein Haloalkane dehalogenase [53514] (4 species)
  7. 2507867Species Xanthobacter autotrophicus [TaxId:280] [53515] (17 PDB entries)
  8. 2507873Domain d1beza_: 1bez A: [34666]
    complexed with acy; mutant

Details for d1beza_

PDB Entry: 1bez (more details), 2.1 Å

PDB Description: haloalkane dehalogenase mutant with trp 175 replaced by tyr at ph 5
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d1beza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1beza_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}
mvnairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftaykydlv
tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
ealkhfaete

SCOPe Domain Coordinates for d1beza_:

Click to download the PDB-style file with coordinates for d1beza_.
(The format of our PDB-style files is described here.)

Timeline for d1beza_: