Lineage for d1bez__ (1bez -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26618Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
  4. 26619Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) (S)
  5. 26738Family c.69.1.8: Haloalkane dehalogenase [53513] (1 protein)
  6. 26739Protein Haloalkane dehalogenase [53514] (3 species)
  7. 26747Species Xanthobacter autotrophicus [53515] (15 PDB entries)
  8. 26752Domain d1bez__: 1bez - [34666]

Details for d1bez__

PDB Entry: 1bez (more details), 2.1 Å

PDB Description: haloalkane dehalogenase mutant with trp 175 replaced by tyr at ph 5

SCOP Domain Sequences for d1bez__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bez__ c.69.1.8 (-) Haloalkane dehalogenase {Xanthobacter autotrophicus}
mvnairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftaykydlv
tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
ealkhfaete

SCOP Domain Coordinates for d1bez__:

Click to download the PDB-style file with coordinates for d1bez__.
(The format of our PDB-style files is described here.)

Timeline for d1bez__: