Lineage for d1edb__ (1edb -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.8: Haloalkane dehalogenase [53513] (1 protein) Protein Haloalkane dehalogenase [53514] (3 species) Species Xanthobacter autotrophicus [53515] (15 PDB entries) 
Domain d1edb__: 1edb - [34665]
Details for d1edb__
PDB Entry: 1edb (more details), 2.01 Å
PDB Description: crystallographic and fluorescence studies of the interaction of haloalkane dehalogenase with halide ions: studies with halide compounds reveal a halide binding site in the active site
SCOP Domain Sequences for d1edb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1edb__ c.69.1.8 (-) Haloalkane dehalogenase {Xanthobacter autotrophicus}
minairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftawkydlv
tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
ealkhfaete
SCOP Domain Coordinates for d1edb__:
Click to download the PDB-style file with coordinates for d1edb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1edb__:
- d1edb__ appears in SCOP 1.57
- d1edb__ appears in the current release, SCOPe 2.08, called d1edba_
View in 3D