SCOPe 2.08: Domain d1edba_: 1edb A:

Lineage for d1edba_ (1edb A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)

6. Protein Haloalkane dehalogenase [53514] (4 species)

7. Species Xanthobacter autotrophicus [TaxId:280] [53515] (17 PDB entries)

8. Domain d1edba_: 1edb A: [34665]
   complexed with cl

Details for d1edba_

PDB Entry: 1edb, 2.01 Å

PDB Description: crystallographic and fluorescence studies of the interaction of haloalkane dehalogenase with halide ions: studies with halide compounds reveal a halide binding site in the active site

PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d1edba_:

Sequence; same for both SEQRES and ATOM records:

>d1edba_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}
minairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftawkydlv
tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
ealkhfaete

Timeline for d1edba_:

• d1edba_ first appeared (with stable ids) in SCOP 1.55, called d1edb__
  
• d1edba_ appears in SCOPe 2.07