![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (80 species) not a true protein |
![]() | Domain d5kofa2: 5kof A:254-406 [346648] Other proteins in same PDB: d5kofa1, d5kofa3, d5kofb1, d5kofc_, d5kofd_ automated match to d1h4fa2 complexed with 6w5 |
PDB Entry: 5kof (more details), 2.4 Å
SCOPe Domain Sequences for d5kofa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kofa2 c.95.1.0 (A:254-406) automated matches {Escherichia coli [TaxId: 562]} yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni vtettdrelttvmsnsfgfggtnatlvmrklkd
Timeline for d5kofa2:
![]() Domains from other chains: (mouse over for more information) d5kofb1, d5kofb2, d5kofc_, d5kofd_ |