Lineage for d5kofa2 (5kof A:254-406)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2488301Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2488302Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2489065Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2489066Protein automated matches [196909] (80 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [254878] (9 PDB entries)
  8. 3046586Domain d5kofa2: 5kof A:254-406 [346648]
    Other proteins in same PDB: d5kofa1, d5kofa3, d5kofb1, d5kofc_, d5kofd_
    automated match to d1h4fa2
    complexed with 6w5

Details for d5kofa2

PDB Entry: 5kof (more details), 2.4 Å

PDB Description: crosslinked crystal structure of type ii fatty acid synthase ketosynthase, fabb, and acyl carrier protein, acpp
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 1

SCOPe Domain Sequences for d5kofa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kofa2 c.95.1.0 (A:254-406) automated matches {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOPe Domain Coordinates for d5kofa2:

Click to download the PDB-style file with coordinates for d5kofa2.
(The format of our PDB-style files is described here.)

Timeline for d5kofa2:

  • d5kofa2 is new in SCOPe 2.07-stable