![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein automated matches [190306] (9 species) not a true protein |
![]() | Species Lysobacter sp. [TaxId:186334] [346641] (1 PDB entry) |
![]() | Domain d5mrtb_: 5mrt B: [346642] automated match to d2h5ca_ complexed with cl, fmt, gol, na |
PDB Entry: 5mrt (more details), 1.6 Å
SCOPe Domain Sequences for d5mrtb_:
Sequence, based on SEQRES records: (download)
>d5mrtb_ b.47.1.1 (B:) automated matches {Lysobacter sp. [TaxId: 186334]} atvqggieyrmplpdgrvglcsvgfpvtkgtikgfataghcakagqsvqisgvnvgtfta shfpntdrawvtigaahtllgsvtnytggsvavkgsteaaigaavcrsgrttqykcgtit aknvtvnygtlgtvsgltrannctgrgdsggswitaagqaqgltsggnlpagqndncsvp tsqrqtyferinpvlsqyglalvts
>d5mrtb_ b.47.1.1 (B:) automated matches {Lysobacter sp. [TaxId: 186334]} atvqggieyrmplpdgrvglcsvgfpvtkgtikgfataghcakagqsvqisgvnvgtfta shfpntdrawvtigaahtllgsvtnytggsvavkgsteaaigaavcrsgrttqykcgtit aknvtvnygtlgtvsgltrannctgrgdsggswitaagqaqgltsggnlparqtyferin pvlsqyglalvts
Timeline for d5mrtb_: