Lineage for d2hada_ (2had A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1869037Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1869038Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1869649Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 1869650Protein Haloalkane dehalogenase [53514] (4 species)
  7. 1869670Species Xanthobacter autotrophicus [TaxId:280] [53515] (17 PDB entries)
  8. 1869676Domain d2hada_: 2had A: [34664]

Details for d2hada_

PDB Entry: 2had (more details), 1.9 Å

PDB Description: crystal structure of haloalkane dehalogenase: an enzyme to detoxify halogenated alkanes
PDB Compounds: (A:) haloalkane dehalogenase

SCOPe Domain Sequences for d2hada_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hada_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}
minairtpdqrfsnldqypfspnylddlpgypglrahyldegnsdaedvflclhgeptws
ylyrkmipvfaesgarviapdffgfgksdkpvdeedytfefhrnfllalierldlrnitl
vvqdwggflgltlpmadpsrfkrliimnaclmtdpvtqpafsafvtqpadgftawkydlv
tpsdlrldqfmkrwaptlteaeasayaapfpdtsyqagvrkfpkmvaqrdqacidistea
isfwqndwngqtfmaigmkdkllgpdvmypmkalingcpepleiadaghfvqefgeqvar
ealkhfaete

SCOPe Domain Coordinates for d2hada_:

Click to download the PDB-style file with coordinates for d2hada_.
(The format of our PDB-style files is described here.)

Timeline for d2hada_: