Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) |
Family d.73.1.0: automated matches [336551] (1 protein) not a true family |
Protein automated matches [336552] (9 species) not a true protein |
Species Thalassiosira antarctica [TaxId:555753] [346585] (1 PDB entry) |
Domain d5mz2p_: 5mz2 P: [346624] Other proteins in same PDB: d5mz2a1, d5mz2a2, d5mz2b1, d5mz2b2, d5mz2c1, d5mz2c2, d5mz2d1, d5mz2d2, d5mz2e1, d5mz2e2, d5mz2f1, d5mz2f2, d5mz2g1, d5mz2g2, d5mz2h1, d5mz2h2 automated match to d1iwab_ complexed with cap, edo, mg |
PDB Entry: 5mz2 (more details), 1.9 Å
SCOPe Domain Sequences for d5mz2p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mz2p_ d.73.1.0 (P:) automated matches {Thalassiosira antarctica [TaxId: 555753]} mrltqgcfsflpdltdqqiekqvacamsrglamnvewtddphprnnywelwglplfdikd patvmfelnearkscaagyirmnafdasygtescvmsfitnrpanepgfyldrtegvgrq ivysiksysvqanpegsry
Timeline for d5mz2p_: