SCOPe 2.07: Domain d5mwxa_: 5mwx A:

Lineage for d5mwxa_ (5mwx A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)

6. Protein Galectin-1 [100925] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (32 PDB entries)
   Uniprot P09382

8. Domain d5mwxa_: 5mwx A: [346614]
   automated match to d1gzwa_
   complexed with bme, so4, wyd

Details for d5mwxa_

PDB Entry: 5mwx, 1.29 Å

PDB Description: galectin-1 in complex with ligand jb60

PDB Compounds: (A:) galectin-1

SCOPe Domain Sequences for d5mwxa_:

Sequence; same for both SEQRES and ATOM records:

>d5mwxa_ b.29.1.3 (A:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
cglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivcn
skdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainyma
adgdfkikcvafd

Timeline for d5mwxa_:

• d5mwxa_ is new in SCOPe 2.07-stable
  
• d5mwxa_ appears in the current release, SCOPe 2.08