Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
Protein automated matches [190453] (25 species) not a true protein |
Species Candidatus kuenenia [TaxId:174633] [346608] (1 PDB entry) |
Domain d5mxza_: 5mxz A: [346609] automated match to d4eifa_ complexed with act, edo, hec, zn; mutant |
PDB Entry: 5mxz (more details), 1.9 Å
SCOPe Domain Sequences for d5mxza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5mxza_ a.3.1.0 (A:) automated matches {Candidatus kuenenia [TaxId: 174633]} idgmklflqhcktchgvdgnptdlgeglgarkfadaewqaktsderiieqinegtpemmm pfkekltpeevkalvpvvrgfk
Timeline for d5mxza_: