Lineage for d5mxza_ (5mxz A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305066Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 2305067Protein automated matches [190453] (25 species)
    not a true protein
  7. 2305077Species Candidatus kuenenia [TaxId:174633] [346608] (1 PDB entry)
  8. 2305078Domain d5mxza_: 5mxz A: [346609]
    automated match to d4eifa_
    complexed with act, edo, hec, zn; mutant

Details for d5mxza_

PDB Entry: 5mxz (more details), 1.9 Å

PDB Description: kustc0563 y40f mutant
PDB Compounds: (A:) Cytochrome c-552 Ks_3358

SCOPe Domain Sequences for d5mxza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mxza_ a.3.1.0 (A:) automated matches {Candidatus kuenenia [TaxId: 174633]}
idgmklflqhcktchgvdgnptdlgeglgarkfadaewqaktsderiieqinegtpemmm
pfkekltpeevkalvpvvrgfk

SCOPe Domain Coordinates for d5mxza_:

Click to download the PDB-style file with coordinates for d5mxza_.
(The format of our PDB-style files is described here.)

Timeline for d5mxza_: