SCOPe 2.07: Domain d1qtra_: 1qtr A:

Lineage for d1qtra_ (1qtr A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins)

6. Protein Proline aminopeptidase [81303] (1 species)

7. Species Serratia marcescens [TaxId:615] [81304] (2 PDB entries)
   Uniprot O32449

8. Domain d1qtra_: 1qtr A: [34660]

Details for d1qtra_

PDB Entry: 1qtr, 2.32 Å

PDB Description: crystal structure analysis of the prolyl aminopeptidase from serratia marcescens

PDB Compounds: (A:) prolyl aminopeptidase

SCOPe Domain Sequences for d1qtra_:

Sequence; same for both SEQRES and ATOM records:

>d1qtra_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}
lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper
ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya
qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq
rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle
sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi
lhqlmiatdrfagk

Timeline for d1qtra_:

• d1qtra_ first appeared (with stable ids) in SCOP 1.55
  
• d1qtra_ appears in SCOPe 2.06
  
• d1qtra_ appears in the current release, SCOPe 2.08