Lineage for d1qtra_ (1qtr A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.7: Proline iminopeptidase [53509] (1 protein) Protein Proline iminopeptidase [53510] (2 species) Species Serratia marcescens [TaxId:615] [53512] (1 PDB entry) 
Domain d1qtra_: 1qtr A: [34660]
Details for d1qtra_
PDB Entry: 1qtr (more details), 2.32 Å
PDB Description: crystal structure analysis of the prolyl aminopeptidase from serratia marcescens
SCOP Domain Sequences for d1qtra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qtra_ c.69.1.7 (A:) Proline iminopeptidase {Serratia marcescens}
lrglypplaaydsgwldtgdghriywelsgnpngkpavfihggpgggisphhrqlfdper
ykvllfdqrgcgrsrphasldnnttwhlvadierlremagveqwlvfggswgstlalaya
qthpervsemvlrgiftlrkqrlhwyyqdgasrffpekwervlsilsdderkdviaayrq
rltsadpqvqleaaklwsvwegetvtllpsresasfgeddfalafarienhyfthlgfle
sddqllrnvplirhipavivhgrydmacqvqnawdlakawpeaelhivegaghsydepgi
lhqlmiatdrfagk
SCOP Domain Coordinates for d1qtra_:
Click to download the PDB-style file with coordinates for d1qtra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qtra_:
- d1qtra_ appears in SCOP 1.57
- d1qtra_ appears in the current release, SCOPe 2.08
View in 3D