Lineage for d5mz2g1 (5mz2 G:3-153)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2519829Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2520025Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2520026Protein automated matches [226983] (24 species)
    not a true protein
  7. 3046536Species Thalassiosira antarctica [TaxId:555753] [346598] (1 PDB entry)
  8. 3046537Domain d5mz2g1: 5mz2 G:3-153 [346599]
    Other proteins in same PDB: d5mz2a2, d5mz2b2, d5mz2c2, d5mz2d2, d5mz2e2, d5mz2f2, d5mz2g2, d5mz2h2, d5mz2i_, d5mz2j_, d5mz2k_, d5mz2l_, d5mz2m_, d5mz2n_, d5mz2o_, d5mz2p_
    automated match to d1bwva2
    complexed with cap, edo, mg

Details for d5mz2g1

PDB Entry: 5mz2 (more details), 1.9 Å

PDB Description: rubisco from thalassiosira antarctica
PDB Compounds: (G:) Rubisco large subunit

SCOPe Domain Sequences for d5mz2g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5mz2g1 d.58.9.0 (G:3-153) automated matches {Thalassiosira antarctica [TaxId: 555753]}
qsvsertriksdryesgvipyakmgywdaaysvkdtdilalfritpqpgvdpveaaaava
gesstatwtvvwtdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslsnlta
siignvfgfkaisalrledmriphsylxtfq

SCOPe Domain Coordinates for d5mz2g1:

Click to download the PDB-style file with coordinates for d5mz2g1.
(The format of our PDB-style files is described here.)

Timeline for d5mz2g1:

  • d5mz2g1 appears in periodic updates to SCOPe 2.07 starting on 2018-04-05