Lineage for d1azwb_ (1azw B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) Superfamily c.69.1: alpha/beta-Hydrolases [53474] (20 families) 
Family c.69.1.7: Proline iminopeptidase [53509] (1 protein) Protein Proline iminopeptidase [53510] (2 species) 
Species Xanthomonas campestris, pv. citri [TaxId:339] [53511] (1 PDB entry) 
Domain d1azwb_: 1azw B: [34659]
Details for d1azwb_
PDB Entry: 1azw (more details), 2.7 Å
PDB Description: proline iminopeptidase from xanthomonas campestris pv. citri
SCOP Domain Sequences for d1azwb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1azwb_ c.69.1.7 (B:) Proline iminopeptidase {Xanthomonas campestris, pv. citri}
mrtlypeitpyqqgslkvddrhtlyfeqcgnphgkpvvmlhggpgggcndkmrrfhdpak
yrivlfdqrgsgrstphadlvdnttwdlvadierlrthlgvdrwqvfggswgstlalaya
qthpqqvtelvlrgifllrrfelewfyqegasrlfpdawehylnaippveradlmsafhr
rltsddeatrlaaakawsvwegatsflhvdedfvtghedahfalafarienhyfvnggff
evedqllrdahriadipgvivhgrydvvcplqsawdlhkawpkaqlqispasghsafepe
nvdalvratdgfa
SCOP Domain Coordinates for d1azwb_:
Click to download the PDB-style file with coordinates for d1azwb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1azwb_:
- d1azwb_ appears in SCOP 1.57
- d1azwb_ appears in the current release, SCOPe 2.08
View in 3D
