| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
| Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins) |
| Protein Acyl carrier protein [47338] (7 species) |
| Species Escherichia coli [TaxId:562] [47339] (26 PDB entries) Uniprot P02901 |
| Domain d5kofc_: 5kof C: [346584] Other proteins in same PDB: d5kofa1, d5kofa2, d5kofa3, d5kofb1, d5kofb2 automated match to d1l0ha_ complexed with 6w5 |
PDB Entry: 5kof (more details), 2.4 Å
SCOPe Domain Sequences for d5kofc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kofc_ a.28.1.1 (C:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyingh
Timeline for d5kofc_: