Lineage for d1azwa_ (1azw A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. Family c.69.1.7: Proline iminopeptidase-like [53509] (4 proteins)
  6. Protein Proline iminopeptidase [53510] (1 species)
  7. Species Xanthomonas campestris, pv. citri [TaxId:339] [53511] (1 PDB entry)
  8. Domain d1azwa_: 1azw A: [34658]

Details for d1azwa_

PDB Entry: 1azw (more details), 2.7 Å

PDB Description: proline iminopeptidase from xanthomonas campestris pv. citri
PDB Compounds: (A:) proline iminopeptidase

SCOPe Domain Sequences for d1azwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]}
mrtlypeitpyqqgslkvddrhtlyfeqcgnphgkpvvmlhggpgggcndkmrrfhdpak
yrivlfdqrgsgrstphadlvdnttwdlvadierlrthlgvdrwqvfggswgstlalaya
qthpqqvtelvlrgifllrrfelewfyqegasrlfpdawehylnaippveradlmsafhr
rltsddeatrlaaakawsvwegatsflhvdedfvtghedahfalafarienhyfvnggff
evedqllrdahriadipgvivhgrydvvcplqsawdlhkawpkaqlqispasghsafepe
nvdalvratdgfa

SCOPe Domain Coordinates for d1azwa_ are not available.

Timeline for d1azwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1azwb_