SCOPe 2.07: Domain d5l8cb_: 5l8c B:

Lineage for d5l8cb_ (5l8c B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [234760] (22 PDB entries)

8. Domain d5l8cb_: 5l8c B: [346567]
   automated match to d4i15a_
   complexed with 908, fmt, gai, gol, mg, peg, zn

Details for d5l8cb_

PDB Entry: 5l8c, 2.01 Å

PDB Description: crystal structure of t. brucei pde-b1 catalytic domain with inhibitor npd-039

PDB Compounds: (B:) phosphodiesterase

SCOPe Domain Sequences for d5l8cb_:

Sequence; same for both SEQRES and ATOM records:

>d5l8cb_ a.211.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vtaitkvereavlvcelpsfdvtdvefdlfrarestdkpldvaaaiayrlllgsglpqkf
gcsdevllnfilqcrkkyrnvpyhnfyhvvdvcqtihtflyrgnvyekltelecfvllit
alvhdldhmglnnsfylktesplgilssasgntsvlevhhcnlaveilsdpesdvfdgle
gaertlafrsmidcvlatdmakhgsaleaflasaadqssdeaafhrmtmeiilkagdisn
vtkpfdisrqwamavteefyrqgdmekergvevlpmfdrsknmelakgqigfidfvaapf
fqkivdaclqgmqwtvdriksnraqwervlet

Timeline for d5l8cb_:

• d5l8cb_ is new in SCOPe 2.07-stable
  
• d5l8cb_ appears in the current release, SCOPe 2.08