Lineage for d5ms4b_ (5ms4 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406349Protein automated matches [190044] (14 species)
    not a true protein
  7. 2406399Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)
  8. 2406563Domain d5ms4b_: 5ms4 B: [346565]
    automated match to d1npma_
    complexed with ca, svc, tbu

Details for d5ms4b_

PDB Entry: 5ms4 (more details), 2.1 Å

PDB Description: kallikrein-related peptidase 8 leupeptin inhibitor complex
PDB Compounds: (B:) Kallikrein-8

SCOPe Domain Sequences for d5ms4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ms4b_ b.47.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlgghecqphsqpwqaalfqgqqllcggvlvggnwvltaahckkpkytvrlgdhslqnkd
gpeqeipvvqsiphpcynssdvedhnhdlmllqlrdqaslgskvkpisladhctqpgqkc
tvsgwgtvtsprenfpdtlncaevkifpqkkcedaypgqitdgmvcagsskgadtcqgds
ggplvcdgalqgitswgsdpcgrsdkpgvytnicryldwikkiigskg

SCOPe Domain Coordinates for d5ms4b_:

Click to download the PDB-style file with coordinates for d5ms4b_.
(The format of our PDB-style files is described here.)

Timeline for d5ms4b_: